Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fava Bean Tamiya

Golden, herb-flecked fava bean fritters—Egypt's street-food staple made in one skillet in under 20 minutes. Serve with tahini sauce and warm pita for a satisfying vegetarian dinner.

Total time
18 min
Servings
2
Calories
320
Protein
12g
Crispy Fava Bean Tamiya
casualwholesomeegyptianvegetarianveganchickpeascrispyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse fava beans, parsley, cilantro, flour, 1 tsp salt, and 0.5 tsp black pepper in a food processor until chunky (not smooth).

  2. Step 2

    Divide mixture into 8 patties, roughly 2 inches wide. Chill 5 minutes if time allows (improves structure).

  3. Step 3

    Heat oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  4. Step 4

    Pan-fry patties 3 minutes per side without moving until edges turn golden brown and crispy.

  5. Step 5

    Whisk tahini with 3 tbsp water, 1 tbsp lemon juice, 1 clove minced garlic, and salt to taste until pourable.

  6. Step 6

    Serve tamiya warm with tahini sauce and warm pita or flatbread.

Tools you’ll need

  • food processor
  • 10-inch skillet
  • spatula
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.