Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Green Fava Ta'ameya

Egyptian street-food magic: bright green fava bean fritters, fried until golden-crispy outside, fluffy within. Takes 15 minutes total and needs just one skillet.

Total time
15 min
Servings
2
Calories
285
Protein
12g
Crispy Green Fava Ta'ameya
casualsatisfyingegyptianvegetarianveganchickpeascrispyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse fava beans, parsley, onion, flour, cumin, 0.5 tsp salt, and 0.25 tsp pepper in a food processor until coarse crumbles form—do not puree.

  2. Step 2

    Scoop into 8 balls, then flatten each into a 2-inch patty. Rest on a plate while oil heats.

  3. Step 3

    Heat oil in a skillet over medium-high until a small piece of mixture sizzles immediately when dropped in, ~2 minutes.

  4. Step 4

    Fry patties 2 minutes per side without moving until golden brown and crispy on both edges.

  5. Step 5

    Transfer to paper towels to drain. Season with a pinch of salt.

  6. Step 6

    Serve hot, preferably in a pita or with tahini sauce for dipping.

Tools you’ll need

  • food processor
  • 10-inch skillet
  • cooking thermometer (optional)
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.