Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spinach & Cheese Börek

Flaky phyllo wrapped around spiced spinach and feta, pan-fried until golden and shattering crisp. Turkish street food in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
12g
Crispy Spinach & Cheese Börek
crispysatisfyingturkishvegetariancheesecrispyflakycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp olive oil in a large skillet over medium-high heat. Add minced onion, cook 1 minute until fragrant.

  2. Step 2

    Add spinach, dill, and nutmeg. Stir continuously for 2–3 minutes until spinach wilts and any liquid evaporates.

  3. Step 3

    Remove pan from heat. Stir in crumbled feta and let cool 2 minutes, then divide filling into 4 portions.

  4. Step 4

    Layer 2 phyllo sheets, brush lightly with olive oil between them. Spread 1 portion filling on one short edge.

  5. Step 5

    Roll tightly into a log, tucking sides in as you go. Repeat with remaining phyllo, oil, and filling for 4 börek.

  6. Step 6

    Wipe skillet clean. Heat 2 tbsp olive oil over medium heat. Pan-fry börek 3–4 minutes per side until deep golden.

Tools you’ll need

  • large skillet
  • wooden spoon
  • pastry brush
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.