Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Batagor: Pan-Fried Fish Dumpling Appetizer

Crispy fried fish and shrimp dumplings with a tangy peanut-based dipping sauce. A beloved Indonesian street food that's simple to assemble and deeply satisfying.

Total time
45 min
Servings
4
Calories
320
Protein
14g
Batagor: Pan-Fried Fish Dumpling Appetizer
casualsatisfyingindonesianfishshrimpcrispytenderweeknight

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix ground fish, garlic, and ginger with a pinch of salt until just combined.

  2. Step 2

    Place 1 tsp filling in the center of each wonton wrapper. Wet edges with water, fold in half, then bring corners together to seal.

  3. Step 3

    Whisk peanut butter, soy sauce, lime juice, and hot water until smooth and pourable. Stir in sliced chili or chili flakes.

  4. Step 4

    Heat oil in a deep skillet or wok to 350°F (175°C). If no thermometer, drop a small piece of wrapper in—it should sizzle immediately.

  5. Step 5

    Fry dumplings in batches, 2–3 minutes per side, until golden brown and crispy. Don't crowd the pan.

  6. Step 6

    Transfer to a paper towel-lined plate to drain. Sprinkle with salt while still hot.

  7. Step 7

    Arrange batagor on a plate. Drizzle or serve peanut sauce on the side. Garnish with sliced green onions.

Tools you’ll need

  • cutting board and knife
  • small bowl for mixing filling
  • small whisk or fork for sauce
  • deep skillet or wok (3-quart minimum)
  • deep-fry thermometer (optional but recommended)
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.