Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Crispy Popiah with Peanut Sauce

Malaysian spring rolls stuffed with stir-fried cabbage, carrots, and shrimp, wrapped in thin crepes and fried until golden. Served with tangy-sweet peanut dipping sauce for the ultimate weeknight dinner.

Total time
25 min
Servings
2
Calories
385
Protein
18g
25-Min Crispy Popiah with Peanut Sauce
casualsatisfyingmalaysianshrimpcrispytenderchewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk peanut butter, sriracha, lime juice, fish sauce, and 2 tbsp warm water in a bowl until smooth and pourable. Set aside.

  2. Step 2

    Heat 1 tbsp oil in a wok or large skillet over medium-high until shimmering, about 60 seconds.

  3. Step 3

    Add shrimp, cook without stirring for 90 seconds until bottoms turn pink, then toss and cook 60 more seconds until just cooked through.

  4. Step 4

    Add cabbage and carrots, stir-fry for 2 minutes until slightly softened but still crisp. Season with salt and pepper, then transfer to a plate.

  5. Step 5

    Lay a wrapper on a clean surface, spoon 2 tbsp filling across the center, roll up tightly, and tuck in the sides like a burrito. Repeat with remaining wrappers.

  6. Step 6

    Heat 2 tbsp oil in the skillet over medium-high until shimmering. Fry popiah seam-side-down, 90 seconds per side until golden and crispy. Serve immediately with peanut sauce.

Tools you’ll need

  • medium bowl
  • wok or 12-inch skillet
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.