CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Min Crispy Popiah with Peanut Sauce

Malaysian spring rolls stuffed with stir-fried cabbage, carrots, and shrimp, wrapped in thin crepes and fried until golden. Served with tangy-sweet peanut dipping sauce for the ultimate weeknight dinner.

Total time
25 min
Servings
2
Calories
385
Protein
18g
25-Min Crispy Popiah with Peanut Sauce
casualsatisfyingmalaysianshrimpcrispytenderchewyweeknight

Ingredients

  • 8 pieces popiah wrappers (thin crepes)
  • 200 g shrimp, peeled and halved lengthwise
  • 2 cups cabbage, shredded
  • 1 medium carrots, julienned
  • 3 tbsp natural peanut butter
  • 1 tbsp sriracha or sambal oelek
  • ½ whole lime (juiced)
  • ½ tsp fish sauce (optional but traditional)

Instructions

  1. 1

    Whisk peanut butter, sriracha, lime juice, fish sauce, and 2 tbsp warm water in a bowl until smooth and pourable. Set aside.

  2. 2

    Heat 1 tbsp oil in a wok or large skillet over medium-high until shimmering, about 60 seconds.

  3. 3

    Add shrimp, cook without stirring for 90 seconds until bottoms turn pink, then toss and cook 60 more seconds until just cooked through.

  4. 4

    Add cabbage and carrots, stir-fry for 2 minutes until slightly softened but still crisp. Season with salt and pepper, then transfer to a plate.

  5. 5

    Lay a wrapper on a clean surface, spoon 2 tbsp filling across the center, roll up tightly, and tuck in the sides like a burrito. Repeat with remaining wrappers.

  6. 6

    Heat 2 tbsp oil in the skillet over medium-high until shimmering. Fry popiah seam-side-down, 90 seconds per side until golden and crispy. Serve immediately with peanut sauce.

Tools you’ll need

  • medium bowl
  • wok or 12-inch skillet
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.