Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fish with Rice & Charred Greens

Whole fish fried until golden and crackling, served over jasmine rice with stir-fried water spinach, sambal heat, and crispy shallots. A complete Vietnamese dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
620
Protein
42g
Crispy Fish with Rice & Charred Greens
satisfyingcasualvietnamesefishcrispytenderweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry inside and out with paper towels. Make 2–3 diagonal slashes on each side.

  2. Step 2

    Heat neutral oil in a large deep skillet to 350°F (a pinch of flour sizzles immediately).

  3. Step 3

    Slide fish into hot oil. Fry 6–7 minutes per side without moving until skin is mahogany-brown and crackling.

  4. Step 4

    Transfer fish to a paper-towel-lined plate. Pour off all but 2 tbsp oil into a bowl.

  5. Step 5

    In the same skillet, stir-fry water spinach and bean sprouts 2 minutes over high heat until wilted but still bright.

  6. Step 6

    Divide rice onto plates, top with fish, greens, and sambal. Drizzle 1 tbsp fish sauce over rice and finish with fried shallots.

Tools you’ll need

  • large deep skillet (10–12 inch)
  • paper towels
  • instant-read thermometer or wooden spoon for oil test
  • slotted spatula
  • plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.