Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chicken Nasi Goreng

Fragrant fried rice with seared chicken, shrimp paste, and bright lime finish. A complete Indonesian dinner ready in under 45 minutes.

Total time
45 min
Servings
4
Calories
520
Protein
28g
Chicken Nasi Goreng
satisfyingcasualindonesianchickenshrimptenderfragrantweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut chicken into 1-inch cubes. Season with salt and black pepper.

  2. Step 2

    Stir shrimp paste with soy sauce and 2 tbsp water until smooth.

  3. Step 3

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering, ~90 seconds.

  4. Step 4

    Add chicken and cook without stirring for 3 minutes until golden on one side.

  5. Step 5

    Stir and cook 2 more minutes until cooked through. Transfer to a plate.

  6. Step 6

    Add remaining 1 tbsp oil to the skillet. Add garlic and chilies, cook 30 seconds until fragrant.

  7. Step 7

    Add shrimp paste mixture and stir for 30 seconds to combine.

  8. Step 8

    Add rice, breaking up clumps, and stir constantly for 3-4 minutes until grains separate and edges begin to brown.

  9. Step 9

    Return chicken to skillet. Stir in lime juice and most of the green onions.

  10. Step 10

    Serve hot. Top with remaining green onions.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.