Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Fried Chicken with Lemongrass and Chilies

Juicy chicken pieces fried until golden and crispy, tossed with fragrant lemongrass and spicy red chilies. A quick and flavorful weeknight dinner.

Total time
25 min
Servings
4
Calories
520
Protein
35g
Crispy Fried Chicken with Lemongrass and Chilies
comfortingAsiangluten-freechickencrispyweeknightmaindinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1.5 lb chicken pieces dry and season with 1 tsp salt. Let sit while you prep the aromatics.

  2. Step 2

    Thinly slice the 2 lemongrass stalks (use only the tender white part) and 4 red chilies; mince the 4 garlic cloves.

  3. Step 3

    Heat 0.5 cup vegetable oil in a large skillet over medium-high. Fry the chicken in a single layer until golden and cooked through, about 8 minutes per side. Remove and set aside.

  4. Step 4

    In the same skillet, reduce heat to medium and sauté the lemongrass, chilies, and garlic until fragrant, about 2 minutes.

  5. Step 5

    Return the chicken to the skillet and toss with the aromatics for 1 minute until well coated. Serve hot.

Tools you’ll need

  • Large skillet
  • Knife
  • Cutting board
  • Tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.