Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fried Fish with Green Sauce & Pickled Carrots

Whole fish fried until golden and crunchy outside, tender inside, served with a vibrant herb-based dipping sauce and quick-pickled carrots. Pure Vietnamese street food simplicity.

Total time
20 min
Servings
2
Calories
520
Protein
42g
Crispy Fried Fish with Green Sauce & Pickled Carrots
casualsatisfyingvietnamesefishcrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss sliced carrots with 3 tbsp vinegar, 1 tbsp water, and a pinch of salt. Let sit while you prep.

  2. Step 2

    Pat both fish dry inside and out. Season generously with salt and pepper inside the cavity and on the skin.

  3. Step 3

    Heat 1.5 inches of neutral oil in a deep skillet or wok to 350°F. Test: a piece of bread browns in 60 seconds.

  4. Step 4

    Slide one fish into the hot oil, fry 5-6 minutes per side without moving until skin is deep golden and crispy.

  5. Step 5

    Repeat with the second fish. Transfer both to a paper-towel-lined plate to drain.

  6. Step 6

    Mix chopped herbs, 2 tbsp lime juice, and 2 tbsp fish sauce in a small bowl to make the dipping sauce.

  7. Step 7

    Serve whole fried fish with pickled carrots alongside and herb sauce for dipping.

Tools you’ll need

  • deep skillet or wok, 12-inch minimum
  • instant-read thermometer
  • tongs or slotted spatula
  • paper towels
  • small mixing bowl
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.