Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fried Fish with Herb Sauce & Pickles

Whole fish fried until golden and crispy, served with a bright cilantro-lime dipping sauce, pickled vegetables, and toasted sesame. This Vietnamese classic comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
42g
Crispy Fried Fish with Herb Sauce & Pickles
casualsatisfyingvietnamesefishcrispyjuicyweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the fish dry inside and out with paper towels. Score the skin with a sharp knife in a crosshatch pattern.

  2. Step 2

    Heat neutral oil in a large skillet or wok to 350°F (a pinch of flour should sizzle immediately when dropped in).

  3. Step 3

    Carefully slide the fish into the hot oil and fry without moving for 6–8 minutes until the skin is deep golden and crispy.

  4. Step 4

    Gently flip and fry the second side for 4–5 minutes until golden. The flesh should flake easily when pierced.

  5. Step 5

    Chop cilantro, mint, and scallions together. Whisk with lime juice, fish sauce, and 2 tbsp water to make the dipping sauce.

  6. Step 6

    Transfer fish to a serving plate. Sprinkle with sesame seeds, salt, and black pepper. Serve with sauce, pickled vegetables, and extra herbs.

Tools you’ll need

  • large skillet or wok, 12+ inches
  • paper towels
  • sharp knife
  • instant-read thermometer (optional but helpful)
  • wide spatula or fish turner
  • small bowl for sauce
  • whisk or spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.