Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Garlic Fish with Dipping Sauce

Whole crispy fish draped in golden garlic and soy-lime sauce—Vietnam's most crave-worthy seafood dinner. Ready in 20 minutes, no fussing required.

Total time
20 min
Servings
2
Calories
485
Protein
52g
Crispy Garlic Fish with Dipping Sauce
casualsatisfyingvietnamesefishcrispyjuicyweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the fish dry inside and out. Season generously with salt and pepper.

  2. Step 2

    Toss the fish in flour to coat all over, shaking off excess.

  3. Step 3

    Heat 3 tbsp oil in a skillet over medium-high until shimmering. Slide the fish in and fry 6 minutes per side without moving, until skin is deep golden and crispy.

  4. Step 4

    Transfer fish to a plate. In the same skillet, cook garlic over medium for 45 seconds until fragrant, stirring constantly.

  5. Step 5

    Remove from heat. Stir in soy sauce, fish sauce, and lime juice.

  6. Step 6

    Pour sauce over the fish. Scatter scallions on top and serve immediately.

Tools you’ll need

  • 12-inch skillet or larger
  • paper towels
  • shallow dish for flour
  • tongs or fish spatula
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.