Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Gion Fish with Broccoli

Golden-fried whole fish with a shatteringly crispy exterior and tender flesh, served alongside steamed broccoli. A Vietnamese restaurant classic that comes together in under 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
45g
Crispy Gion Fish with Broccoli
satisfyingsimplevietnamesefishcrispytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a pot of salted water to a boil. Add broccoli and steam until tender-crisp, about 5 minutes. Drain and set aside.

  2. Step 2

    Pat fish dry inside and out with paper towels. Score the skin diagonally 3 times on each side. Season generously with salt.

  3. Step 3

    Heat oil in a deep skillet or wok to 350°F (use a thermometer). Working with one fish at a time, carefully slide it into the hot oil.

  4. Step 4

    Fry 5–6 minutes per side without moving, until skin is deep golden and crispy. Use a slotted spoon to flip gently once.

  5. Step 5

    Whisk together fish sauce, lime juice, minced garlic, and 2 tbsp water. Pour over the fish and broccoli on a serving plate.

  6. Step 6

    Serve immediately while the fish is still crispy.

Tools you’ll need

  • large pot (for steaming broccoli)
  • deep skillet or wok (12-inch minimum)
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • small bowl (for dipping sauce)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.