Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Halloumi & Egg Tomato Skillet

A Mediterranean one-pan breakfast with wilted spinach, a tangle of sweet tomatoes, fried halloumi, and eggs that stay runny in the center. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
24g
Crispy Halloumi & Egg Tomato Skillet
freshlightmediterraneanvegetarianeggscheesecrispyrunny

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat halloumi dry, then slice into 0.5-inch-thick planks.

  2. Step 2

    Heat olive oil in a 10-inch skillet over medium-high until shimmering.

  3. Step 3

    Fry halloumi until golden and crispy on both sides, ~2 minutes each. Transfer to a plate.

  4. Step 4

    Add red onion to the same skillet, sauté until soft, ~2 minutes.

  5. Step 5

    Add cherry tomatoes and oregano, cook until tomatoes start to burst, ~3 minutes.

  6. Step 6

    Nestle spinach into the gaps and stir until wilted, ~1 minute.

  7. Step 7

    Crack eggs directly into the skillet, spacing them apart, then cover and cook until whites set but yolks jiggle, ~4 minutes.

  8. Step 8

    Slide halloumi back in, scatter feta if using, then serve straight from the pan.

Tools you’ll need

  • 10-inch non-stick or cast iron skillet
  • cutting board
  • chef's knife
  • slotted spatula
  • lid or large plate (for covering skillet)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.