Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Halloumi, Spinach & Egg Skillet

Mediterranean one-pan breakfast with juicy tomatoes, wilted spinach, crispy halloumi, and perfectly cooked eggs. Ready in 15 minutes.

Total time
15 min
Servings
2
Calories
385
Protein
28g
Crispy Halloumi, Spinach & Egg Skillet
freshsimplemediterraneanvegetarianeggscheesecrispytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a 10-inch skillet over medium-high until shimmering.

  2. Step 2

    Slice halloumi 1/4-inch thick. Pan-fry 90 seconds per side until golden. Remove and set aside.

  3. Step 3

    Add remaining oil. Toss in halved cherry tomatoes and spinach. Stir until spinach wilts, about 60 seconds.

  4. Step 4

    Crack eggs directly over the skillet, spacing them evenly. Season with salt and pepper.

  5. Step 5

    Cover with a lid. Cook over medium until whites set but yolks still jiggle, 3–4 minutes.

  6. Step 6

    Slide onto a plate. Top with crispy halloumi. Serve hot.

Tools you’ll need

  • 10-inch nonstick skillet
  • lid
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.