CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Halloumi, Spinach & Egg Skillet

Mediterranean one-pan breakfast with juicy tomatoes, wilted spinach, crispy halloumi, and perfectly cooked eggs. Ready in 15 minutes.

Total time
15 min
Servings
2
Calories
385
Protein
28g
Crispy Halloumi, Spinach & Egg Skillet
freshsimplemediterraneanvegetarianeggscheesecrispytender

Ingredients

  • 8 oz halloumi cheese
  • 1 cup cherry tomatoes
  • 2 cups fresh spinach
  • 4 whole eggs
  • 2 tbsp olive oil
  • 1 pinch salt and pepper

Instructions

  1. 1

    Heat 1 tbsp oil in a 10-inch skillet over medium-high until shimmering.

  2. 2

    Slice halloumi 1/4-inch thick. Pan-fry 90 seconds per side until golden. Remove and set aside.

  3. 3

    Add remaining oil. Toss in halved cherry tomatoes and spinach. Stir until spinach wilts, about 60 seconds.

  4. 4

    Crack eggs directly over the skillet, spacing them evenly. Season with salt and pepper.

  5. 5

    Cover with a lid. Cook over medium until whites set but yolks still jiggle, 3–4 minutes.

  6. 6

    Slide onto a plate. Top with crispy halloumi. Serve hot.

Tools you’ll need

  • 10-inch nonstick skillet
  • lid
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.