Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Herb & Feta Stuffed Peppers

Sweet roasted peppers packed with herby chickpeas, crispy breadcrumbs, and tangy feta. Ready in under 25 minutes—no long braise needed.

Total time
25 min
Servings
4
Calories
285
Protein
11g
Crispy Herb & Feta Stuffed Peppers
comfortwholesomemediterraneanvegetarianchickpeascheesecrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Arrange pepper halves cut-side up on a sheet pan. Drizzle with olive oil, salt, and pepper.

  2. Step 2

    Roast peppers in a 425°F oven for 10 minutes until they soften slightly around the edges.

  3. Step 3

    While peppers roast, toss chickpeas, feta, breadcrumbs, red onion, and fresh herbs in a bowl.

  4. Step 4

    Squeeze lemon juice over the filling. Stir and taste; adjust salt and pepper as needed.

  5. Step 5

    Divide filling evenly among pepper halves, packing gently so breadcrumbs stay visible on top.

  6. Step 6

    Return to oven and roast 10 minutes more until breadcrumbs turn golden and peppers are tender.

Tools you’ll need

  • sheet pan
  • medium mixing bowl
  • oven (425°F)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.