Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Hilopites with Butter & Herbs

Tender hand-torn egg pasta crisped in browned butter with fresh herbs—pure Greek comfort in 25 minutes. No sauce, no fuss, just golden, nutty, and totally addictive.

Total time
25 min
Servings
2
Calories
420
Protein
10g
Crispy Hilopites with Butter & Herbs
simplecomfortgreekvegetarianvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Make a well, crack eggs into it, then stir with a fork until shaggy dough forms.

  2. Step 2

    Knead dough on a clean counter until smooth and elastic, about 3 minutes. Rest it covered while you bring a pot of salted water to a boil.

  3. Step 3

    Break dough into small, irregular pieces roughly the size of a pea. Drop into boiling water and cook until they float, then 2 more minutes.

  4. Step 4

    Drain pasta well. Heat butter in a large skillet over medium-high until edges turn golden brown and smell nutty, about 2 minutes.

  5. Step 5

    Add drained pasta to hot butter and toss constantly until edges crisp and turn pale gold, 3–4 minutes. The pan should sound loud and sizzly.

  6. Step 6

    Remove from heat. Pour lemon juice over top, add fresh dill, toss once. Taste and adjust salt. Serve immediately.

Tools you’ll need

  • large mixing bowl
  • fork
  • pot for boiling
  • large skillet, 10-inch minimum
  • wooden spoon or tongs
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.