Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Khandvi Rolls

Silky gram-flour spirals, steamed in minutes, then pan-fried until edges crisp. Finished with mustard tempering and fresh cilantro—pure umami comfort.

Total time
18 min
Servings
2
Calories
185
Protein
6g
Crispy Khandvi Rolls
comfortsimpleindianvegetarianveganchickpeassilkycrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk gram flour, water, turmeric, chili, and ginger in a bowl until smooth and lump-free.

  2. Step 2

    Pour batter into a large nonstick skillet over medium heat, stirring constantly until it thickens and pulls from the sides, ~6 minutes.

  3. Step 3

    Spread the thick batter onto a parchment-lined plate or board while still warm; let cool 2 minutes.

  4. Step 4

    Cut the sheet into strips, then roll each loosely and arrange seam-side down in the same skillet.

  5. Step 5

    Sear rolls over medium-high heat until edges are golden and crisp, ~3 minutes; flip and sear the other side.

  6. Step 6

    Push rolls aside, add oil and mustard seeds to the pan, let seeds pop, then drizzle over rolls and serve.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • large nonstick skillet, 12-inch
  • wooden spoon
  • parchment paper
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.