Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Lamb-Stuffed Eggplant

Tender eggplant rounds stuffed with spiced ground lamb and topped with crispy breadcrumbs. Ready in 20 minutes with a sheet pan and one bowl.

Total time
20 min
Servings
4
Calories
385
Protein
28g
Crispy Lamb-Stuffed Eggplant
comfortrusticsyrianlambcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice eggplant into 0.5-inch rounds. Pat dry with paper towels.

  2. Step 2

    Brown ground lamb with onion in a large skillet over medium-high heat, breaking up with a spoon, until no pink remains, ~5 minutes.

  3. Step 3

    Stir pomegranate molasses and parsley into the lamb. Season with salt and pepper to taste.

  4. Step 4

    Arrange eggplant rounds on the skillet around the lamb. Sprinkle breadcrumbs over each round.

  5. Step 5

    Cover with a lid and cook over medium heat for 8 minutes until eggplant is tender and breadcrumbs begin to brown.

  6. Step 6

    Remove lid and serve hot, spooning lamb mixture over each eggplant round.

Tools you’ll need

  • 12-inch skillet with lid
  • cutting board
  • knife
  • paper towels
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.