Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Leek & Gruyère Skillet Pie

Caramelized leeks and melted Gruyère baked in a crispy phyllo crust—a 20-minute weeknight take on the French classic. Savory, buttery, and completely satisfying.

Total time
20 min
Servings
4
Calories
285
Protein
11g
Crispy Leek & Gruyère Skillet Pie
comfortelegantfrenchvegetariancheesecrispycreamymelty

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp butter in a 10-inch oven-safe skillet over medium-high. Add leeks, salt, and pepper; stir occasionally until golden and soft, 8–10 minutes.

  2. Step 2

    Stir in mustard and thyme. Spread leeks evenly. Scatter Gruyère across the top.

  3. Step 3

    Melt remaining 1 tbsp butter. Brush one phyllo sheet with melted butter, lay it on the leeks. Repeat with remaining 3 sheets, brushing each.

  4. Step 4

    Brush the top phyllo layer with remaining butter. Transfer skillet to a 400°F oven and bake until golden brown, 8–10 minutes.

  5. Step 5

    Remove from oven. Let cool 2 minutes, then slice into wedges and serve hot.

Tools you’ll need

  • 10-inch oven-safe skillet
  • cutting board
  • chef's knife
  • wooden spoon
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.