Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Gratin de Cardons

Tender cardoons in a silky béchamel sauce, baked until golden and bubbling. A classic French vegetable gratin with Gruyère crust.

Total time
50 min
Servings
4
Calories
285
Protein
12g
Gratin de Cardons
comfortelegantfrenchvegetariancreamytendercrispyweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Trim cardoons: remove outer strings with a vegetable peeler, then cut into 2-inch pieces.

  2. Step 2

    Bring a large pot of salted water with lemon juice to a boil.

  3. Step 3

    Add cardoons and simmer until tender when pierced with a fork, 20–25 minutes.

  4. Step 4

    Drain cardoons well in a colander. Pat dry with paper towels.

  5. Step 5

    Heat butter in a medium saucepan over medium heat until foaming, ~1 minute.

  6. Step 6

    Whisk in flour to form a paste. Cook, stirring, until fragrant and light brown, 1 minute.

  7. Step 7

    Gradually whisk in milk, ensuring no lumps form. Simmer 2–3 minutes until slightly thickened.

  8. Step 8

    Remove from heat. Stir in 0.5 cup Gruyère, salt, pepper, and nutmeg until cheese melts.

  9. Step 9

    Heat oven to 400°F. Coat a 9-by-13-inch baking dish with olive oil.

  10. Step 10

    Spread drained cardoons in dish. Pour béchamel evenly over top.

  11. Step 11

    Sprinkle remaining 0.25 cup Gruyère over sauce. Bake until top is golden and edges bubble, 12–15 minutes.

  12. Step 12

    Let rest 3 minutes, then serve hot.

Tools you’ll need

  • vegetable peeler
  • large pot
  • colander
  • medium saucepan
  • whisk
  • 9-by-13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.