Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Miso Butter Onigiri with Pickles

Pan-seared rice balls with a glossy miso-butter crust, served alongside tangy pickled cucumbers. Ready in 15 minutes — the ultimate weeknight bite.

Total time
15 min
Servings
2
Calories
285
Protein
5g
Crispy Miso Butter Onigiri with Pickles
quicksatisfyingjapanesevegetarianvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Wet your hands lightly with water. Divide rice into 4 equal portions, then pack each into a tight ball.

  2. Step 2

    Wrap one nori strip around the base of each rice ball, pressing gently so it adheres.

  3. Step 3

    Mix miso, butter, and soy sauce in a small bowl until smooth and fully combined.

  4. Step 4

    Heat a skillet over medium-high heat. Place onigiri seam-side down and sear 2–3 minutes until the bottom turns deep golden brown.

  5. Step 5

    Brush the miso-butter mixture onto each onigiri's top and sides, then flip and sear 90 seconds more until glossy and caramelized.

  6. Step 6

    Serve hot alongside pickled cucumbers.

Tools you’ll need

  • small bowl
  • 12-inch skillet or larger

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.