Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Missi Roti with Chili Oil

Chickpea flour flatbread studded with caramelized onions and spices, pan-fried until golden and crispy. Serve with chili oil for dipping and a squeeze of lemon—ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
240
Protein
8g
Crispy Missi Roti with Chili Oil
comfortsatisfyingindianvegetarianveganchickpeascrispysoft

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a skillet over medium-high. Add sliced onions, cook 5-6 minutes, stirring, until deeply golden and fragrant.

  2. Step 2

    Mix chickpea flour, turmeric, carom seeds, green chili, salt, and pepper in a bowl. Add golden onions and stir to combine.

  3. Step 3

    Pour warm water slowly into the flour mixture, stirring until you have a thick, sticky dough that comes together.

  4. Step 4

    Heat remaining 1 tbsp chili oil in the skillet over medium-high until it shimmers, about 90 seconds.

  5. Step 5

    Drop a large spoonful of dough onto the hot skillet. Use the back of the spoon to flatten into a rough 4-inch round, about 0.25-inch thick.

  6. Step 6

    Cook 2-3 minutes per side until edges curl, surface blisters, and color turns golden-brown. Flip once. Repeat with remaining dough.

Tools you’ll need

  • 12-inch skillet or cast-iron pan
  • medium mixing bowl
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.