Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Monterey Jack Quesadillas

Grilled flour tortillas stuffed with shredded Monterey Jack and warm grilled chicken, served with fresh vegetables and salad on the side. Ready in 15 minutes with a skillet and three ingredients.

Total time
15 min
Servings
2
Calories
520
Protein
32g
Crispy Monterey Jack Quesadillas
quickcasualmexicanchickencrispymeltytenderweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a 10-inch skillet over medium-high until a drop of water sizzles on contact.

  2. Step 2

    Place one tortilla in the skillet, scatter 1/4 cup chicken and 1/4 cup cheese on half.

  3. Step 3

    Fold tortilla in half and cook 2 minutes until edges turn golden brown.

  4. Step 4

    Flip and cook 1 minute more until the second side is golden and cheese melts through.

  5. Step 5

    Slide onto a plate and repeat with remaining 3 tortillas, chicken, and cheese.

  6. Step 6

    Serve hot with grilled vegetables and salad on the side.

Tools you’ll need

  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.