Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pan-Fried Gnocchi with Sage Butter

Pillowy gnocchi gets shattered into crispy golden chunks in a skillet, then tossed with nutty browned butter and fresh sage. Restaurant-level comfort in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Crispy Pan-Fried Gnocchi with Sage Butter
comfortsimpleitalianvegetariancrispycreamyweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp butter in a large skillet over medium-high heat until it shimmers.

  2. Step 2

    Add gnocchi in a single layer and let it sear without stirring for 4 minutes until golden brown on the bottom.

  3. Step 3

    Stir gnocchi and cook another 3 minutes until most pieces are crispy and light golden all over.

  4. Step 4

    Push gnocchi to the edges; add remaining 1 tbsp butter and sage to the center, mashing sage to release flavor.

  5. Step 5

    Toss everything together until gnocchi is coated and sage is fragrant, about 1 minute.

  6. Step 6

    Divide between bowls and top with parmesan cheese; serve immediately while crispy.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon or spatula
  • 2 bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.