CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pan-Fried Gnocchi with Sage Butter

Pillowy gnocchi gets shattered into crispy golden chunks in a skillet, then tossed with nutty browned butter and fresh sage. Restaurant-level comfort in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Crispy Pan-Fried Gnocchi with Sage Butter
comfortsimpleitalianvegetariancrispycreamyweeknightpasta

Ingredients

  • 1 lb gnocchi
  • 3 tbsp butter
  • 8 leaves fresh sage leaves
  • ½ cup parmesan cheese, grated

Instructions

  1. 1

    Heat 2 tbsp butter in a large skillet over medium-high heat until it shimmers.

  2. 2

    Add gnocchi in a single layer and let it sear without stirring for 4 minutes until golden brown on the bottom.

  3. 3

    Stir gnocchi and cook another 3 minutes until most pieces are crispy and light golden all over.

  4. 4

    Push gnocchi to the edges; add remaining 1 tbsp butter and sage to the center, mashing sage to release flavor.

  5. 5

    Toss everything together until gnocchi is coated and sage is fragrant, about 1 minute.

  6. 6

    Divide between bowls and top with parmesan cheese; serve immediately while crispy.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon or spatula
  • 2 bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.