Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pancit Canton

Filipino stir-fried noodles loaded with cabbage, carrots, and crispy edges. Ready in 15 minutes with one skillet and pantry staples.

Total time
15 min
Servings
4
Calories
285
Protein
8g
Crispy Pancit Canton
quicksatisfyingfilipinovegetarianvegetariancrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over high heat until it shimmers, about 90 seconds.

  2. Step 2

    Add garlic and cook 30 seconds until fragrant, stirring constantly so it doesn't burn.

  3. Step 3

    Add cooked noodles and spread flat. Let them sit undisturbed for 2 minutes to crisp up on the bottom.

  4. Step 4

    Toss noodles with a spatula, breaking up clumps. Add cabbage and carrot; stir-fry 3 minutes until vegetables soften.

  5. Step 5

    Drizzle soy sauce and sesame oil over everything. Toss for 1 minute until evenly coated and fragrant.

  6. Step 6

    Slide onto a plate and top with sliced scallion. Serve hot.

Tools you’ll need

  • large skillet (12-inch cast iron or carbon steel preferred for crispy edges)
  • spatula or wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.