Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Minute Pancit Canton

Crispy egg noodles tossed with garlic, soy, and fresh veggies in one hot skillet. The Filipino street-food classic that cooks faster than takeout.

Total time
15 min
Servings
2
Calories
380
Protein
10g
15-Minute Pancit Canton
quicksatisfyingfilipinovegetarianvegetariancrispychewyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil noodles in salted water until just tender, about 4 minutes. Drain well and set aside.

  2. Step 2

    Heat oil in a large skillet over medium-high until it shimmers, about 60 seconds.

  3. Step 3

    Add garlic and cook, stirring constantly, until fragrant, about 30 seconds.

  4. Step 4

    Toss in the vegetables and stir-fry for 2 minutes until they begin to soften.

  5. Step 5

    Add the noodles and soy sauce, tossing constantly until noodles are coated and edges turn crispy and golden, about 2 minutes.

  6. Step 6

    Finish with white pepper, toss once more, and serve immediately while hot.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling
  • wooden spoon or spatula
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.