Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pesto Mozzarella Flatbread

Flatbread brushed with pesto, topped with fresh mozzarella and cherry tomatoes, then baked until the cheese melts and edges crisp. A 15-minute Italian weeknight dinner.

Total time
15 min
Servings
2
Calories
380
Protein
14g
Crispy Pesto Mozzarella Flatbread
simplefreshitalianvegetariancrispymeltyweeknightpizza

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place flatbread on a sheet pan or pizza stone.

  2. Step 2

    Spread pesto evenly across the flatbread, leaving a thin border.

  3. Step 3

    Tear mozzarella into bite-sized pieces and scatter across the pesto.

  4. Step 4

    Halve the cherry tomatoes and distribute over the cheese.

  5. Step 5

    Bake at 425°F until cheese melts and edges turn golden, 8–10 minutes.

  6. Step 6

    Slide onto a cutting board and serve hot.

Tools you’ll need

  • sheet pan or pizza stone
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.