Back to recipes
Crispy Margherita Tortilla
A thin-crust pizza made on a tortilla—tomato, fresh mozzarella, and basil baked until the edges crisp and cheese melts. Ready in under 10 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 12g
simplequickitalianvegetariancrispymeltyweeknightpizza
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Place tortillas on a baking sheet lined with foil.
Step 2
Divide tomato slices between tortillas, leaving a 1/2-inch border.
Step 3
Top each tortilla with half the mozzarella, spacing it evenly.
Step 4
Bake at 425°F until cheese melts and edges turn golden brown.
Step 5
Top with fresh basil leaves while still warm.
Step 6
Slice and serve immediately.
Tools you’ll need
- baking sheet
- foil
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
