Back to recipes
15-Min Pesto Flatbread
Crispy flatbread topped with bright basil pesto, melty mozzarella, and burst cherry tomatoes—ready in the time it takes to preheat your oven. No sauce, no fuss, just pure Italian vibes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 420
- Protein
- 16g
freshquickitalianvegetariancrispymeltyweeknightpizza
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 425°F.
Step 2
Spread pesto evenly across the flatbread, leaving a thin border.
Step 3
Scatter mozzarella over the pesto, then scatter tomato halves on top.
Step 4
Slide onto a baking sheet and bake until cheese melts and edges crisp, ~6 minutes.
Step 5
Slice and serve hot.
Tools you’ll need
- oven
- baking sheet
- knife
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
