15-Min Pesto Flatbread
Crispy flatbread topped with bright basil pesto, melty mozzarella, and burst cherry tomatoes—ready in the time it takes to preheat your oven. No sauce, no fuss, just pure Italian vibes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 420
- Protein
- 16g

freshquickitalianvegetariancrispymeltyweeknightpizza
Ingredients
- 1 large (or 2 small) flatbread
- 3 tbsp pesto
- 1 cup mozzarella cheese, shredded
- 1 cup cherry tomatoes, halved
Instructions
- 1
Preheat oven to 425°F.
- 2
Spread pesto evenly across the flatbread, leaving a thin border.
- 3
Scatter mozzarella over the pesto, then scatter tomato halves on top.
- 4
Slide onto a baking sheet and bake until cheese melts and edges crisp, ~6 minutes.
- 5
Slice and serve hot.
Tools you’ll need
- oven
- baking sheet
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



