Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Potato & Cheese Gratin

Thinly sliced potatoes layered with Gruyère and cream, baked until golden and bubbly. A French Alpine classic that tastes like you spent hours but takes just 20 minutes.

Total time
20 min
Servings
4
Calories
485
Protein
18g
20-Min Crispy Potato & Cheese Gratin
comfortcozyfrenchvegetariancheesecrispycreamytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Butter an 8×10-inch baking dish generously.

  2. Step 2

    Slice potatoes 1/8-inch thick (use a mandoline if you have one). Pat dry with paper towels.

  3. Step 3

    Whisk cream, milk, garlic, salt, and pepper in a bowl until combined.

  4. Step 4

    Layer half the potatoes in the baking dish, overlapping slightly. Sprinkle half the cheese. Add remaining potatoes, then remaining cheese.

  5. Step 5

    Pour cream mixture over the top. Bake at 425°F until the surface turns golden and edges are bubbling, 16–18 minutes.

  6. Step 6

    Let rest 2 minutes. Serve hot with crusty bread or a simple salad.

Tools you’ll need

  • 8x10-inch baking dish
  • mandoline slicer (optional, or sharp knife)
  • whisk
  • measuring cups
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.