Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Potato Gratin with Baked Chicken

Creamy, golden potato gratin baked in one pan alongside chicken breast. A warm, satisfying dinner that feels fancy but comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
38g
Crispy Potato Gratin with Baked Chicken
comfortcozyfrenchgluten-freechickencreamycrispytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat chicken dry and season all over with salt and pepper.

  2. Step 2

    Arrange potato slices in a buttered 10-inch baking dish, overlapping slightly.

  3. Step 3

    Whisk cream, garlic, and half the cheese in a bowl. Pour over potatoes.

  4. Step 4

    Nestle chicken breasts on top of potatoes. Sprinkle remaining cheese over chicken.

  5. Step 5

    Bake until chicken is cooked through (165°F internal temp) and potatoes are tender and golden, 16–18 minutes.

  6. Step 6

    Rest 2 minutes. Serve straight from the baking dish.

Tools you’ll need

  • 10-inch baking dish
  • instant-read thermometer
  • whisk
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.