Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Raclette with Crispy Potatoes

Melted raclette cheese over roasted potatoes, mushrooms, and onions — no special equipment needed. Finish with a crack of black pepper and fresh herbs for a cozy French-inspired weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
16g
Sheet-Pan Raclette with Crispy Potatoes
comfortcozyfrenchvegetariancheesecrispymeltytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Toss potatoes, mushrooms, and onion with oil, salt, and pepper on a large sheet pan.

  2. Step 2

    Spread in an even layer. Roast for 15 minutes until potatoes are mostly tender and edges start to brown.

  3. Step 3

    Pull the pan from the oven. Arrange raclette slices over the vegetables, covering most of the surface.

  4. Step 4

    Return to the oven for 2–3 minutes until cheese melts completely and edges just start to bubble.

  5. Step 5

    Remove from oven. Scatter fresh herbs and a pinch of black pepper over the top.

  6. Step 6

    Serve immediately while cheese is still molten.

Tools you’ll need

  • large sheet pan (16 x 12 inches minimum)
  • chef's knife
  • cutting board
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.