Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Potato & Cheese Krokiety

Polish potato-and-cheese rolls, fried until golden and crunchy. A nostalgic vegetarian comfort dish that tastes like street food but comes together in 20 minutes.

Total time
20 min
Servings
4
Calories
485
Protein
12g
Crispy Potato & Cheese Krokiety
comfortnostalgicpolishvegetariancheesecrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel potatoes, cut into chunks, and boil in salted water until fork-tender, ~10 minutes. Drain and mash with salt and pepper until smooth.

  2. Step 2

    Fold shredded cheese into warm mashed potatoes. Cool for 2 minutes until handleable.

  3. Step 3

    Set up three shallow bowls: flour in one, beaten egg in the second, panko in the third. Shape potato mixture into 8 logs, each 3 inches long.

  4. Step 4

    Coat each log in flour, then egg, then panko, pressing gently so crumbs stick. Place on a plate.

  5. Step 5

    Heat oil in a large skillet over medium-high until a breadcrumb sizzles immediately when dropped in. Fry logs 2–3 minutes per side until deep golden brown.

  6. Step 6

    Transfer to a paper-towel-lined plate. Serve hot with sour cream or mustard for dipping.

Tools you’ll need

  • large pot
  • colander
  • potato masher
  • three shallow bowls
  • large skillet
  • instant-read or candy thermometer (optional)
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.