Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Chicken Vol-au-Vent Bites

Buttery puff-pastry shells filled with tender chicken in a silky cream sauce—ready in 20 minutes. Fancy enough for company, simple enough for Tuesday.

Total time
20 min
Servings
4
Calories
385
Protein
22g
Creamy Chicken Vol-au-Vent Bites
elegantcomfortfrenchchickencreamycrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bake frozen vol-au-vents on a sheet pan at 400°F for 12 minutes until golden and puffed.

  2. Step 2

    While they bake, melt butter in a skillet over medium heat, then stir in shredded chicken, cream, and broth.

  3. Step 3

    Add Dijon mustard and tarragon, then simmer gently for 3–4 minutes until sauce thickens slightly.

  4. Step 4

    Season with salt and pepper to taste.

  5. Step 5

    Spoon creamy chicken into each pastry shell and serve immediately.

Tools you’ll need

  • sheet pan
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.