Back to recipes
Crispy Pretzel Bites
Soft, chewy pretzel pieces tossed in melted butter and coarse salt, then air-fried until golden and crispy on the outside. Ready in 10 minutes with zero rising time required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 185
- Protein
- 3g
casualquickamericanvegetariancrispychewysnackweeknight
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat air fryer to 380°F for 2 minutes.
Step 2
Melt butter in a small bowl and stir in garlic powder, salt, and pepper.
Step 3
Toss frozen pretzel bites with butter mixture until evenly coated.
Step 4
Spread in air fryer basket and cook 6–8 minutes until golden brown.
Step 5
Pour onto paper towels. Serve warm.
Tools you’ll need
- air fryer
- small bowl
- spoon
- paper towels
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
