Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Rice Stuffed Cabbage

Tender cabbage leaves wrapped around seasoned rice and herbs, pan-fried until edges crisp up. A vegetarian take on Greek lahanodolmades that skips the long simmer for a weeknight-friendly sheet-pan finish.

Total time
18 min
Servings
4
Calories
145
Protein
3g
Crispy Rice Stuffed Cabbage
comfortwholesomegreekvegetarianvegantendercrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil water in a pot. Carefully peel off 8 whole cabbage leaves and blanch them 3 minutes until pliable.

  2. Step 2

    Pat leaves dry on a kitchen towel. Mix rice, dill, mint, lemon juice, salt, and pepper in a bowl.

  3. Step 3

    Place 3 tbsp rice mixture at the center of each leaf. Roll tightly, tucking in the sides as you go.

  4. Step 4

    Heat olive oil in a large skillet over medium-high until it shimmers, about 60 seconds.

  5. Step 5

    Arrange rolls seam-side down in the skillet. Sear for 3 minutes until the bottom edges turn light golden.

  6. Step 6

    Flip and sear the other side 2 minutes. Serve hot, drizzled with extra lemon juice if desired.

Tools you’ll need

  • 12-inch skillet
  • large pot
  • mixing bowl
  • kitchen towel
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.