Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Saltfish & Ackee

Salty, flaky saltfish paired with buttery, tender ackee in a 20-minute Caribbean dinner. Toast onions and peppers, warm the ackee gently, and serve with crusty bread.

Total time
20 min
Servings
2
Calories
285
Protein
22g
Crispy Saltfish & Ackee
wholesomesimplecaribbeanfishflakytendercrispyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high. Add onion and bell pepper, cook until edges char and soften, ~5 minutes.

  2. Step 2

    Stir in the minced hot pepper and thyme. Cook until fragrant, about 60 seconds.

  3. Step 3

    Add flaked saltfish and toss gently to combine, warming through, ~2 minutes.

  4. Step 4

    Fold in the ackee with a gentle hand—it breaks apart easily. Warm for 1 minute without stirring.

  5. Step 5

    Taste and season with salt and pepper. Serve hot with crusty bread or boiled green bananas.

Tools you’ll need

  • large skillet (10–12 inch)
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.