10-Min Crispy Samosa with Chutney
Store-bought samosas crisped in a skillet until shattering golden, served with tomato ketchup and fresh green chilies. TikTok-easy, zero shame, pure satisfaction.
- Total time
- 10 min
- Servings
- 2
- Calories
- 280
- Protein
- 4g

casualsatisfyingindianvegetarianvegetariancrispyflakysnack
Ingredients
- 4 pieces frozen samosas (vegetable or potato-filled)
- 2 tbsp neutral oil for frying
- 3 tbsp tomato ketchup
- 2 pieces fresh green chilies, sliced
- ¼ tsp salt
- ⅛ tsp black pepper
Instructions
- 1
Heat oil in a medium skillet over medium-high until shimmering, about 90 seconds.
- 2
Slide samosas into the oil without crowding. Fry 2 minutes per side until deep golden and crispy.
- 3
Transfer to a plate. Season lightly with salt and pepper while still hot.
- 4
Dollop ketchup on the plate and scatter green chilies alongside. Serve immediately.
Tools you’ll need
- medium skillet (10-12 inch)
- tongs or slotted spoon
- paper towels
- small plate
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



