Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Crispy Samosa with Chutney

Store-bought samosas crisped in a skillet until shattering golden, served with tomato ketchup and fresh green chilies. TikTok-easy, zero shame, pure satisfaction.

Total time
10 min
Servings
2
Calories
280
Protein
4g
10-Min Crispy Samosa with Chutney
casualsatisfyingindianvegetarianvegetariancrispyflakysnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a medium skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Slide samosas into the oil without crowding. Fry 2 minutes per side until deep golden and crispy.

  3. Step 3

    Transfer to a plate. Season lightly with salt and pepper while still hot.

  4. Step 4

    Dollop ketchup on the plate and scatter green chilies alongside. Serve immediately.

Tools you’ll need

  • medium skillet (10-12 inch)
  • tongs or slotted spoon
  • paper towels
  • small plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.