10-Minute Crispy Samosa with Tomato Chutney
Store-bought samosas crisped in a skillet until golden and served with tangy tomato chutney and fresh cilantro. Ready in minutes—no frying oil required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 185
- Protein
- 3g

casualquickindianvegetarianvegetariancrispyflakysnack
Ingredients
- 6 pieces frozen samosas
- 1 tbsp neutral oil (for pan)
- ½ cup tomato chutney
- 2 tbsp fresh cilantro, chopped
- ¼ tsp salt
Instructions
- 1
Heat oil in a medium skillet over medium-high until shimmering, about 1 minute.
- 2
Add samosas in a single layer. Cook 2–3 minutes per side until golden brown and crispy.
- 3
Transfer samosas to a plate. Sprinkle with salt.
- 4
Serve warm alongside tomato chutney. Garnish with fresh cilantro.
Tools you’ll need
- medium skillet
- tongs or spatula
- plate
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



