Back to recipes
10-Minute Crispy Samosa with Tomato Chutney
Store-bought samosas crisped in a skillet until golden and served with tangy tomato chutney and fresh cilantro. Ready in minutes—no frying oil required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 185
- Protein
- 3g
casualquickindianvegetarianvegetariancrispyflakysnack
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Heat oil in a medium skillet over medium-high until shimmering, about 1 minute.
Step 2
Add samosas in a single layer. Cook 2–3 minutes per side until golden brown and crispy.
Step 3
Transfer samosas to a plate. Sprinkle with salt.
Step 4
Serve warm alongside tomato chutney. Garnish with fresh cilantro.
Tools you’ll need
- medium skillet
- tongs or spatula
- plate
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
