Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Puchka (Gol Gappay)

Crispy hollow spheres filled with spiced potatoes, chickpeas, and tangy tamarind water—a beloved Indian street snack. Assemble and serve immediately for maximum crunch.

Total time
45 min
Servings
4
Calories
285
Protein
7g
Puchka (Gol Gappay)
casualfreshindianvegetarianchickpeascrispysoftsnack

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes until fork-tender, ~15 minutes. Drain, cool, and dice into 1/4-inch cubes.

  2. Step 2

    Drain and rinse canned chickpeas. Mix in a bowl with diced potato, cumin, chili powder, and ginger-garlic paste.

  3. Step 3

    Whisk tamarind paste with 1 cup water to make tamarind water. Taste and adjust salt and spice level.

  4. Step 4

    Mix flour with 1 tbsp oil, 1/4 tsp salt, and 1/2 cup water. Knead into a smooth, soft dough for 2 minutes.

  5. Step 5

    Divide dough into 16 balls. Roll each into a thin disk 2-3 inches across.

  6. Step 6

    Heat 2 cups oil to 350°F in a deep skillet or wok. If no thermometer, oil is ready when a small piece of dough sizzles immediately.

  7. Step 7

    Gently slide one disk into hot oil. It will sink, then float. Fry 10-15 seconds per side until light golden and puffed.

  8. Step 8

    Transfer puffed disk to paper towels. Once cooled, gently poke a hole in the side and crimp open a 1-inch mouth.

  9. Step 9

    Repeat with remaining dough disks. You should have 16 hollow puffed spheres.

  10. Step 10

    Spoon 1 tbsp potato-chickpea filling into each puffed sphere. Drizzle 1 tbsp tamarind water over the top.

  11. Step 11

    Garnish with cilantro. Serve immediately while puffas are still crispy. Eat in one bite.

Tools you’ll need

  • medium pot for boiling potatoes
  • mixing bowls (2)
  • whisk
  • dough board or counter
  • rolling pin
  • deep skillet or wok (10-12 inches)
  • instant-read thermometer or oil thermometer
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.