Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Shrimp Pancakes

Crispy golden crepes loaded with sizzling shrimp, lettuce, and fresh herbs—no fancy equipment needed. Whip up a quick batter, pan-fry until golden, and wrap in lettuce for a snack that tastes restaurant-quality.

Total time
15 min
Servings
2
Calories
285
Protein
18g
15-Min Crispy Shrimp Pancakes
freshquickvietnameseshrimpcrispytenderBreakfastsnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, water, salt, and turmeric in a bowl until smooth with no lumps.

  2. Step 2

    Heat 2 tbsp oil in a 10-inch nonstick skillet over medium-high heat until shimmering.

  3. Step 3

    Pour 1/4 cup batter in, tilt skillet to spread thin, scatter shrimp on top, cook until edges curl and surface looks lacy, about 2 minutes.

  4. Step 4

    Flip carefully and cook the other side until golden and crispy, about 90 seconds.

  5. Step 5

    Slide onto a plate and repeat with remaining batter and shrimp to make 2–3 more crepes.

  6. Step 6

    Serve crepes with lettuce leaves and fresh herbs on the side for wrapping.

Tools you’ll need

  • 10-inch nonstick skillet
  • mixing bowl
  • whisk or fork
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.