CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Crispy Shrimp Pancakes with Green Mango

Impossibly crispy golden pancakes loaded with shrimp, finished with bright green mango slaw. This is the TikTok version—no complicated batter resting, just pan and heat.

Total time
15 min
Servings
2
Calories
285
Protein
22g
15-Min Crispy Shrimp Pancakes with Green Mango
quicksatisfyingvietnameseshrimpcrispytenderBreakfastweeknight

Ingredients

  • ½ lb shrimp, peeled and deveined
  • ¾ cup all-purpose flour
  • ¾ cup coconut milk
  • 1 medium green mango, shredded
  • 1 tbsp fish sauce
  • 2 stalks scallion, sliced thin

Instructions

  1. 1

    Whisk flour, coconut milk, 1 tsp salt, and fish sauce until smooth batter forms, no lumps.

  2. 2

    Heat 2 tbsp oil in a 10-inch nonstick skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Pour half the batter in, swirl to spread thin, scatter half the shrimp on top. Cook undisturbed 2 minutes.

  4. 4

    Flip when edges crisp and pull from the pan—golden brown spots should cover the surface. Cook 90 seconds more.

  5. 5

    Slide onto a plate. Repeat with remaining batter and shrimp using another tablespoon of oil.

  6. 6

    Top pancakes with shredded green mango and sliced scallion. Serve immediately with extra fish sauce for dipping.

Tools you’ll need

  • 10-inch nonstick skillet
  • whisk
  • mixing bowl
  • rubber spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.