Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Shrimp Bánh Khot

Golden-crispy Vietnamese shrimp pancakes with turmeric batter, topped with fresh herbs and tangy fish sauce dip. Pan-fried until the edges curl and the bottom crisps, ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
22g
Crispy Shrimp Bánh Khot
casualfreshvietnameseshrimpcrispytenderweeknightdate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk rice flour, turmeric, and salt together, then stir in coconut milk and 0.25 cup water until smooth batter forms.

  2. Step 2

    Mix fish sauce and lime juice in a small bowl for dipping sauce; set aside.

  3. Step 3

    Heat 2 tbsp oil in a 10-inch nonstick skillet over medium-high until shimmering, about 90 seconds.

  4. Step 4

    Pour half the batter into the skillet and arrange half the shrimp on top. Let cook undisturbed for 3–4 minutes until bottom edges turn golden and crispy.

  5. Step 5

    Flip the pancake carefully, cook another 1–2 minutes until the second side is light golden. Transfer to a plate and repeat with remaining batter and shrimp.

  6. Step 6

    Top pancakes with green onion and fresh herbs, drizzle with fish sauce dip, and serve hot.

Tools you’ll need

  • 10-inch nonstick skillet
  • whisk
  • small bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.