Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Steak with Mashed Potatoes & Onions

Thin-sliced flank steak seared until crispy, served Colombian-style with creamy mashed potatoes, pickled red onions, and fresh lettuce. Comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
620
Protein
52g
20-Min Crispy Steak with Mashed Potatoes & Onions
comfortsatisfyingcolombianbeefcrispytendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Dice potatoes into 1-inch cubes. Place in a pot of cold salted water and bring to boil.

  2. Step 2

    Toss red onion slices with vinegar and a pinch of salt in a small bowl. Let sit while you cook.

  3. Step 3

    Pat steak slices dry. Season generously with salt and black pepper on both sides.

  4. Step 4

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering. Working in batches, sear steak 60 seconds per side until edges brown. Transfer to a plate.

  5. Step 5

    Pour broth into the pan, scraping up browned bits. Return steak to pan, toss to coat, then remove heat.

  6. Step 6

    Drain potatoes when fork-tender. Mash with 3 tbsp butter, a splash of milk, salt, and pepper until creamy.

  7. Step 7

    Arrange mashed potatoes, steak with pan sauce, pickled onions, and fresh lettuce on each plate. Serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • medium pot
  • small mixing bowl
  • wooden spoon or spatula
  • potato masher
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.