Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tempeh Goreng

Golden-fried tempeh with a savory soy-garlic glaze and a hit of sambal heat. Perfectly crunchy outside, tender inside — authentic Indonesian street food in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
18g
Crispy Tempeh Goreng
casualsatisfyingindonesianvegetarianvegandairy-freetempehcrispy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice tempeh 1/4-inch thick, then cut each slab into 3-inch rectangles.

  2. Step 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Add tempeh in a single layer and fry 3 minutes per side until golden and crispy. Work in batches if needed.

  4. Step 4

    Push tempeh to the side. Add garlic and sambal to the oil and cook 30 seconds until fragrant.

  5. Step 5

    Pour soy sauce over everything and toss gently to coat. Cook 1 minute to reduce slightly.

  6. Step 6

    Squeeze lime juice over the top and garnish with green onion. Serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board and knife
  • wooden spoon or spatula
  • small prep bowl (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.