CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Tempeh Goreng

Golden-fried tempeh with a savory soy-garlic glaze and a hit of sambal heat. Perfectly crunchy outside, tender inside — authentic Indonesian street food in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
18g
Crispy Tempeh Goreng
casualsatisfyingindonesianvegetarianvegandairy-freetempehcrispy

Ingredients

  • 8 oz tempeh
  • 3 tbsp neutral oil for frying
  • 2 tbsp soy sauce
  • 3 cloves garlic, minced
  • 1 tbsp sambal oelek or chili paste
  • ½ whole lime
  • 2 stalks green onion, sliced

Instructions

  1. 1

    Slice tempeh 1/4-inch thick, then cut each slab into 3-inch rectangles.

  2. 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Add tempeh in a single layer and fry 3 minutes per side until golden and crispy. Work in batches if needed.

  4. 4

    Push tempeh to the side. Add garlic and sambal to the oil and cook 30 seconds until fragrant.

  5. 5

    Pour soy sauce over everything and toss gently to coat. Cook 1 minute to reduce slightly.

  6. 6

    Squeeze lime juice over the top and garnish with green onion. Serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board and knife
  • wooden spoon or spatula
  • small prep bowl (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.