Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tostadas with Black Beans & Cheese

Crispy-fried tortillas topped with warm black beans, melted cheese, and fresh toppings. Ready in 10 minutes—perfect for quick snacks or a light meal.

Total time
10 min
Servings
2
Calories
285
Protein
9g
Crispy Tostadas with Black Beans & Cheese
casualquickmexicanvegetariancheesecrispymeltyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a 10-inch skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Fry one tortilla until crispy and light brown on both sides, about 90 seconds total. Transfer to a plate.

  3. Step 3

    Repeat with remaining tortillas, frying one at a time until all are golden and crispy.

  4. Step 4

    Spread 3 tablespoons of warm black beans onto each crispy tortilla base.

  5. Step 5

    Sprinkle cheese evenly over beans on each tostada.

  6. Step 6

    Top with diced tomato and cilantro. Serve immediately while the cheese is still warm and melted.

Tools you’ll need

  • 10-inch skillet
  • tongs
  • paper towels
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.