Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tostadas with Charred Corn & Queso

Crunchy corn tostadas loaded with charred corn, melted cheese, and bright lime crema. Sheet-pan dinner that tastes like a taquería in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Crispy Tostadas with Charred Corn & Queso
quickcasualmexicanvegetariancheesecrispymeltyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a large skillet over medium-high heat. Toss corn with a pinch of salt and spread in a single layer.

  2. Step 2

    Cook corn without stirring until charred on one side, ~3 minutes. Stir and cook another 2 minutes until edges are dark.

  3. Step 3

    Arrange tostada shells on the skillet (work in batches if needed). Top each with a handful of cheese.

  4. Step 4

    Cover with a lid or foil and cook over medium heat until cheese melts and shells are warm, ~2 minutes.

  5. Step 5

    Stir sour cream with the juice of half the lime. Season with salt to taste.

  6. Step 6

    Top each tostada with charred corn, a drizzle of lime crema, and a few jalapeño slices. Serve immediately.

Tools you’ll need

  • 12-inch skillet with lid or foil
  • cutting board and knife
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.