Custrd is out on the App Store — Download it free →
Back to recipes

Crusted Fish Salad with Greens and Berries

A quick and vibrant salad featuring crispy coated fish fillets over mixed greens, topped with fresh berries, olives, and beets, all tossed in a simple vinaigrette.

Total time
20 min
Servings
2
Calories
450
Protein
30g
Crusted Fish Salad with Greens and Berries
lightfreshamericangluten-freefishcrispyfreshweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat dry 2 fish fillets and season with salt and pepper. Press both sides into 0.5 cup panko breadcrumbs to coat evenly.

  2. Step 2

    Heat 2 tbsp olive oil in a skillet over medium-high. Cook the coated fillets until golden and crispy, about 3-4 minutes per side, until the fish flakes easily with a fork.

  3. Step 3

    In a large bowl, toss 4 cups mixed greens with 0.25 cup vinaigrette dressing until lightly coated.

  4. Step 4

    Divide the dressed greens between two plates. Top with 1 cup sliced strawberries and 0.5 cup raspberries.

  5. Step 5

    Place a crispy fish fillet on each salad. Add olives and sliced beets if you have them, then serve immediately.

Tools you’ll need

  • skillet
  • large bowl
  • plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.