Custrd is out on the App Store — Download it free →
Back to recipes

Curry Dishes

A rich and aromatic curry with tender meat chunks, soft onions, and a creamy sauce, garnished with fresh cilantro and whole star anise.

Total time
50 min
Servings
4
Calories
450
Protein
35g
Curry Dishes
comfortingIndiangluten-freemeatcreamytenderweeknightcurry

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a pot and sauté chopped onions until golden brown.

  2. Step 2

    Add minced garlic and ginger, cook for 1 minute until fragrant.

  3. Step 3

    Add meat chunks and brown on all sides for 5 minutes.

  4. Step 4

    Stir in curry powder and star anise, cook for 2 minutes.

  5. Step 5

    Pour in 2 cups water, cover and simmer for 30 minutes until meat is tender.

  6. Step 6

    Stir in cream and simmer for 5 minutes until sauce thickens.

  7. Step 7

    Garnish with fresh cilantro and serve hot.

Tools you’ll need

  • large pot
  • wooden spoon
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.