Custrd is out on the App Store — Download it free →
Back to recipes

Egg and Arugula Bagel Sandwich

A crispy fried egg, melted cheese, and fresh arugula piled onto a toasted bagel. Ready in minutes, perfect for breakfast or a quick lunch.

Total time
10 min
Servings
1
Calories
450
Protein
20g
Egg and Arugula Bagel Sandwich
comfortingquickamericanvegetarianeggcrispysoftweekday

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the bagel in half and toast it until golden and crisp, about 3 minutes.

  2. Step 2

    Melt 1 tbsp butter in a small skillet over medium heat. Crack in 1 egg and cook until the white is set and the edges are crispy, about 3 minutes. Sprinkle with a pinch of salt.

  3. Step 3

    Flip the egg, lay 1 slice of cheddar on top, and cook until the cheese melts and the yolk is still runny, about 1 minute.

  4. Step 4

    Place the egg-cheese stack on the bottom bagel half, top with 1 handful of arugula, and close with the top half. Serve warm.

  5. Step 5

    If you like, add a dash of hot sauce or black pepper before closing the sandwich.

Tools you’ll need

  • toaster
  • small skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.